PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G051200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 315aa    MW: 33753.5 Da    PI: 5.3748
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G051200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44e-10128176351
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                         + k+ rr+++NR +A +sR++Kk +++ Le k+k Leae  +L   l+ 
  Sevir.1G051200.1.p 128 DGKKKRRRMRNRDSAMKSREKKKLYVKDLEMKSKYLEAECCRLSYALQC 176
                         5699***********************************9888766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.4E-14125189No hitNo description
SMARTSM003381.9E-5126190IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.795128170IPR004827Basic-leucine zipper domain
PfamPF001704.9E-9130185IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-11130188No hitNo description
PROSITE patternPS000360133148IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAAAGFRGGG EYDLPLEEVD AVLASFSGDP AAVFAPLPAP EAVAGASREL LAPGEGLREG  60
LGEVEKFLME DYENEAGVDG VDEFLNGVFV GDGEDDGSPK TTGERSADGA SAGEDEEVAG  120
ADGGDDPDGK KKRRRMRNRD SAMKSREKKK LYVKDLEMKS KYLEAECCRL SYALQCCAAE  180
NMALRQSLLK DRPVGAPTAM QESAVLTETL PLVSLLWLVS IVCLFLTPGV PNRSLVAPSS  240
LGRDLAKLAR TSTKGVKMFR VATNRDDPRS LELVRLGRRC RCARARIKSP WLPWYAVAAT  300
AGRRSSCKPS LSCC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129134KKKRRR
2132149RRRMRNRDSAMKSREKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951593.10.0PREDICTED: bZIP transcription factor 60-like
TrEMBLK3YUA10.0K3YUA1_SETIT; Uncharacterized protein
STRINGSi017847m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.13e-12basic region/leucine zipper motif 60